PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011100353.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 183aa    MW: 19660 Da    PI: 10.1193
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011100353.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.91e-4175150277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cq+e+C+adlseak+yhr hkvCe+h+ka+vv+v+g++qrfCqqCsrfhelsefDe+krsCrrrLa+hnerrrk+ 
  XP_011100353.1  75 CQAEKCSADLSEAKTYHRLHKVCEHHAKAQVVVVAGIRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKNP 150
                     **************************************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.104.2E-3370136IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.51372149IPR004333Transcription factor, SBP-box
SuperFamilySSF1036129.03E-3874153IPR004333Transcription factor, SBP-box
PfamPF031101.8E-3175148IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MEANIYRISG LKPKPMKGKM KKDGAAESED DELIMGGGGA ADQDDKRKRG ATGGSSTRKG  60
SAGGGGSGAI STKSCQAEKC SADLSEAKTY HRLHKVCEHH AKAQVVVVAG IRQRFCQQCS  120
RFHELSEFDE AKRSCRRRLA GHNERRRKNP TENTQAEGST GSRIKGGNTP GSGQLKDIFC  180
GHV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-3865148184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00634PBMTransfer from PK22320.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100353.11e-132PREDICTED: squamosa promoter-binding protein 1-like
SwissprotQ9S7A94e-41SPL4_ARATH; Squamosa promoter-binding-like protein 4
TrEMBLA0A022RQ556e-61A0A022RQ55_ERYGU; Uncharacterized protein
STRINGVIT_12s0028g03350.t012e-52(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74924105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G53160.28e-41squamosa promoter binding protein-like 4